Recombinant Human FAAP24 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BTP7

Gene Name: FAAP24

Expression System: Escherichia coli

Molecular Weight: 17 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 82%

Start Site: Pro11

End Site: Pro140

Coverage: 0.66

Isoelectric Point: 7.5

Core Sequence: PVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKEP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Pig - 85%, Cynomolgus monkey - 97%

Alternative gene names: C19orf40

Alternative protein names: Fanconi anemia core complex-associated protein 24; Fanconi anemia-associated protein of 24 kDa

Protein name: FA core complex associated protein 24

Full length: 215 amino acids

Entry name: FAP24_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10351-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10351-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 91442