Recombinant Human FAM120C Protein

Recombinant Human FAM120C Protein
SKU
ASBPP-2842-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NX05

Gene Name: FAM120C

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 83%

Start Site: Ile951

End Site: Val1090

Coverage: 0.14

Isoelectric Point: 11

Core Sequence: IPPQGGKLEIAGMVVGQWAGSRSSRGRGSFGMQVVSVGGPGKGHGKEQTGRGSKGHKKGNKQGSSDGVSKSLELHQGRSRSQVNGNSGALIKEEKSDHRLPAPSQCALSRDSNECNNGNRYLPMNNREKNHLQEQKLETV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 83%, Pig - 88%, Cynomolgus monkey - 98%

Alternative gene names: CXorf17

Alternative protein names: Constitutive coactivator of PPAR-gamma-like protein 2; Protein FAM120C; Tumor antigen BJ-HCC-21

Protein name: family with sequence similarity 120 member C

Full length: 1096 amino acids

Entry name: F120C_HUMAN
More Information
SKU ASBPP-2842-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2842-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 54954
Product information (PDF)
×
MSDS (PDF)
×