Recombinant Human FAM124B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H5Z6

Gene Name: FAM124B

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 51%

Start Site: Gln291

End Site: Val410

Coverage: 0.29

Isoelectric Point: 10

Core Sequence: QGHSLELPEPSGSPTSDRCAGTSWKSPGRSFQVSSPAMGAHLHLSSHHLESGARMKVLNRENSFQKLEAETNVDTGLTIINSEPRQTYFGGFPRDLQTSQPPFCLPASSLGVATSKNNSV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 51%, Pig - 64%, Cynomolgus monkey - 89%

Alternative gene names: /

Alternative protein names: Protein FAM124B

Protein name: family with sequence similarity 124 member B

Full length: 455 amino acids

Entry name: F124B_HUMAN

• SKU: ASBPP-2766-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2766-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 79843