Recombinant Human FGFR1OP2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NVK5

Gene Name: FGFR1OP2

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Ser131

End Site: Ser240

Coverage: 0.47

Isoelectric Point: 5.5

Core Sequence: SKIDMVHRNKSEGFFLDASRHILEAPQHGLERRHLEANQNELQAHVDQITEMAAVMRKAIEIDEQQGCKEQERIFQLEQENKGLREILQITRESFLNLRKDDASESTSLS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 98%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: FGFR1 oncogene partner 2

Protein name: FGFR1 oncogene partner 2

Full length: 253 amino acids

Entry name: FGOP2_HUMAN

• SKU: ASBPP-2834-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2834-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 26127