Recombinant Human FOXN2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P32314

Gene Name: FOXN2

Expression System: Escherichia coli

Molecular Weight: 22.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 38%

Start Site: Arg231

End Site: Ile410

Coverage: 0.45

Isoelectric Point: 5.5

Core Sequence: RNLKESDIDAAAAMMLLNTSIEQGILECEKPLPLKTALQKKRSYGNAFHHPSAVRLQESDSLATSIDPKEDHNYSASSMAAQRCASRSSVSSLSSVDEVYEFIPKNSHVGSDGSEGFHSEEDTDVDYEDDPLGDSGYASQPCAKISEKGQSGKKMRKQTCQEIDEELKEAAGSLLHLAGI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 38%, Pig - 91%, Cynomolgus monkey - 97%

Alternative gene names: HTLF

Alternative protein names: Forkhead box protein N2; Human T-cell leukemia virus enhancer factor

Protein name: forkhead box N2

Full length: 431 amino acids

Entry name: FOXN2_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10357-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10357-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 3344