Note: Dry Ice fees will be extra-charged
Uniprot: P41250
Gene Name: GARS1
Expression System: Escherichia coli
Molecular Weight: 10.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 95%
Start Site: Glu61
End Site: Arg130
Coverage: 0.11
Isoelectric Point: 8
Core Sequence: EEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKR
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 95%, Pig - 96%, Cynomolgus monkey - 100%
Alternative gene names: GARS
Alternative protein names: Glycine--tRNA ligase; Diadenosine tetraphosphate synthetase; Ap4A synthetase; Glycyl-tRNA synthetase; GlyRS; Glycyl-tRNA synthetase 1
Protein name: glycyl-tRNA synthetase 1
Full length: 739 amino acids
Entry name: GARS_HUMAN
Product panel: Autoimmune Disease,Enzyme
English
Deutsch
