Recombinant Human GRIA3 Protein

Recombinant Human GRIA3 Protein
SKU
ASBPP-291-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P42263

Gene Name: GRIA3

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Asn741

End Site: Gly810

Coverage: 0.09

Isoelectric Point: 8.5

Core Sequence: NEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 99%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: GLUR3; GLURC

Alternative protein names: Glutamate receptor 3; GluR-3; AMPA-selective glutamate receptor 3; GluR-C; GluR-K3; Glutamate receptor ionotropic; AMPA 3; GluA3

Protein name: glutamate ionotropic receptor AMPA type subunit 3

Full length: 894 amino acids

Entry name: GRIA3_HUMAN
More Information
SKU ASBPP-291-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-291-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 2892
Product information (PDF)
×
MSDS (PDF)
×