Recombinant Human GRIK1 Protein

Recombinant Human GRIK1 Protein
SKU
ASBPP-278-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P39086

Gene Name: GRIK1

Expression System: Escherichia coli

Molecular Weight: 29.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Ser291

End Site: Ala530

Coverage: 0.28

Isoelectric Point: 7.5

Core Sequence: SSIIEKWSMERLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRASQLTVSSLQCHRHKPWRLGPRFMNLIKEARWDGLTGHITFNKTNGLRKDFDLDIISLKEEGTEKAAGEVSKHLYKVWKKIGIWNSNSGLNMTDSNKDKSSNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Rat - 95%, Pig - 97%, Cynomolgus monkey - 100%

Alternative gene names: GLUR5

Alternative protein names: Glutamate receptor ionotropic; kainate 1; GluK1; Excitatory amino acid receptor 3; EAA3; Glutamate receptor 5; GluR-5; GluR5

Protein name: glutamate ionotropic receptor kainate type subunit 1

Full length: 918 amino acids

Entry name: GRIK1_HUMAN

Product panel: Neuroscience Biomarkers
More Information
SKU ASBPP-278-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-278-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 2897
Product information (PDF)
×
MSDS (PDF)
×