Recombinant Human GTF3C4 Protein

Recombinant Human GTF3C4 Protein
SKU
ASBPP-2908-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UKN8

Gene Name: GTF3C4

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Ser611

End Site: Glu680

Coverage: 0.09

Isoelectric Point: 4.5

Core Sequence: SPGMGNADDEQQEEGTSSKQVVKQGLQERSKEGDVEEPTDDSLPTTGDAGGREPMEEKLLEIQGKIEAVE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Pig - 76%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: General transcription factor 3C polypeptide 4; TF3C-delta; Transcription factor IIIC 90 kDa subunit; TFIIIC 90 kDa subunit; TFIIIC90; Transcription factor IIIC subunit delta

Protein name: general transcription factor IIIC subunit 4

Full length: 822 amino acids

Entry name: TF3C4_HUMAN

Product panel: DNA binding & Chromatin,Enzyme
More Information
SKU ASBPP-2908-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2908-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 9329
Product information (PDF)
×
MSDS (PDF)
×