Recombinant Human HMGXB4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UGU5

Gene Name: HMGXB4

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 43%

Start Site: Leu381

End Site: Ala490

Coverage: 0.20

Isoelectric Point: 10.5

Core Sequence: LHTDGHSEKKKKKEEKDKERERGEKPKKKNMSAYQVFCKEYRVTIVADHPGIDFGELSKKLAEVWKQLPEKDKLIWKQKAQYLQHKQNKAEATTVKRKASSSEGSMKVKA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 43%, Rat - 43%, Pig - 95%, Cynomolgus monkey - 98%

Alternative gene names: HMG2L1; HMGBCG

Alternative protein names: HMG domain-containing protein 4; HMG box-containing protein 4; High mobility group protein 2-like 1; Protein HMGBCG

Protein name: HMG-box containing 4

Full length: 601 amino acids

Entry name: HMGX4_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2890-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2890-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 10042