Recombinant Human INTS6 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UL03

Gene Name: INTS6

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 82%

Start Site: Pro671

End Site: Ala790

Coverage: 0.15

Isoelectric Point: 6

Core Sequence: PVVNNHIGGKGPPAPTTQAQPDLIKPLPLHKISETTNDSIIHDVVENHVADQLSSDITPNAMDTEFSASSPASLLERPTNHMEALGHDHLGTNDLTVGGFLENHEEPRDKEQCAEENIPA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Pig - 91%, Cynomolgus monkey - 99%

Alternative gene names: DBI1; DDX26; DDX26A

Alternative protein names: Integrator complex subunit 6; Int6; DBI-1; Protein DDX26; Protein deleted in cancer 1; DICE1

Protein name: integrator complex subunit 6

Full length: 887 amino acids

Entry name: INT6_HUMAN

• SKU: ASBPP-2909-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2909-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 26512