Recombinant Human KCNH3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9ULD8

Gene Name: KCNH3

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Asp661

End Site: Asp830

Coverage: 0.16

Isoelectric Point: 6.5

Core Sequence: DVKGLTYCVLQCLQLAGLHDSLALYPEFAPRFSRGLRGELSYNLGAGGGSAEVDTSSLSGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTAPRPRLGGRGRPGRAGALKAEAGPSAPPRALEGLRLPPMPWNVPPDLSPRVVDGIED

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 94%, Pig - 89%, Cynomolgus monkey - 100%

Alternative gene names: KIAA1282

Alternative protein names: Potassium voltage-gated channel subfamily H member 3; Brain-specific eag-like channel 1; BEC1; Ether-a-go-go-like potassium channel 2; ELK channel 2; ELK2; Voltage-gated potassium channel subunit Kv12.2

Protein name: potassium voltage-gated channel subfamily H member 3

Full length: 1083 amino acids

Entry name: KCNH3_HUMAN

• SKU: ASBPP-2917-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2917-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 23416