Recombinant Human KIDINS220 Protein

Recombinant Human KIDINS220 Protein
SKU
ASBPP-2920-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9ULH0

Gene Name: KIDINS220

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Arg1551

End Site: Asn1720

Coverage: 0.10

Isoelectric Point: 6

Core Sequence: RVPKSPEHSAEPIRTFIKAKEYLSDALLDKKDSSDSGVRSSESSPNHSLHNEVADDSQLEKANLIELEDDSHSGKRGIPHSLSGLQDPIIARMSICSEDKKSPSECSLIASSPEENWPACQKAYNLNRTPSTVTLNNNSAPANRANQNFDEMEGIRETSQVILRPSSSPN

Homologies: Highest protein sequence identity to the following orthologs: Rat - 92%, Pig - 95%, Cynomolgus monkey - 99%

Alternative gene names: ARMS; KIAA1250

Alternative protein names: Kinase D-interacting substrate of 220 kDa; Ankyrin repeat-rich membrane-spanning protein

Protein name: kinase D interacting substrate 220

Full length: 1771 amino acids

Entry name: KDIS_HUMAN

Product panel: Neuroscience Biomarkers
More Information
SKU ASBPP-2920-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2920-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 57498
Product information (PDF)
×
MSDS (PDF)
×