Recombinant Human MEAF6 Protein

Recombinant Human MEAF6 Protein
SKU
ASBPP-2781-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9HAF1

Gene Name: MEAF6

Expression System: Escherichia coli

Molecular Weight: 22.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Met1

End Site: Tyr191

Coverage: 1.00

Isoelectric Point: 10

Core Sequence: MAMHNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAVSALAGVQDQLIEKREPGSGTESDTSPDFHNQENEPSQEDPEDLDGSVQGVKPQKAASSTSSGSHHSSHKKRKNKNRHRIDLKLNKKPRADY

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Pig - 100%, Cynomolgus monkey - 99%

Alternative gene names: C1orf149; CENP-28; EAF6

Alternative protein names: Chromatin modification-related protein MEAF6; MYST/Esa1-associated factor 6; Esa1-associated factor 6 homolog; Protein EAF6 homolog; hEAF6; Sarcoma antigen NY-SAR-91

Protein name: MYST/Esa1 associated factor 6

Full length: 191 amino acids

Entry name: EAF6_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2781-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2781-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 64769
Product information (PDF)
×
MSDS (PDF)
×