Recombinant Human MEAF6 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HAF1

Gene Name: MEAF6

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Lys81

End Site: Asp180

Coverage: 0.57

Isoelectric Point: 7

Core Sequence: KFKEAERLFSKSSVTSAAAVSALAGVQDQLIEKREPGSGTESDTSPDFHNQENEPSQEDPEDLDGSVQGVKPQKAASSTSSGSHHSSHKKRKNKNRHRID

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: C1orf149; CENP-28; EAF6

Alternative protein names: Chromatin modification-related protein MEAF6; MYST/Esa1-associated factor 6; Esa1-associated factor 6 homolog; Protein EAF6 homolog; hEAF6; Sarcoma antigen NY-SAR-91

Protein name: MYST/Esa1 associated factor 6

Full length: 191 amino acids

Entry name: EAF6_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2782-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2782-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 64769