Recombinant Human MLYCD Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O95822

Gene Name: MLYCD

Expression System: Escherichia coli

Molecular Weight: 31 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 87%

Start Site: Lys211

End Site: Gly470

Coverage: 0.57

Isoelectric Point: 8

Core Sequence: KISEAEAVHPVKNWMDMKRRVGPYRRCYFFSHCSTPGEPLVVLHVALTGDISSNIQAIVKEHPPSETEEKNKITAAIFYSISLTQQGLQGVELGTFLIKRVVKELQREFPHLGVFSSLSPIPGFTKWLLGLLNSQTKEHGRNELFTDSECKEISEITGGPINETLKLLLSSSEWVQSEKLVRALQTPLMRLCAWYLYGEKHRGYALNPVANFHLQNGAVLWRINWMADVSLRGITGSCGLMANYRYFLEETGPNSTSYLG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Rat - 87%, Pig - 83%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Malonyl-CoA decarboxylase; mitochondrial; MCD

Protein name: malonyl-CoA decarboxylase

Full length: 493 amino acids

Entry name: DCMC_HUMAN

Product panel: Enzyme

• SKU: ASBPP-5800-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-5800-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 23417