Note: Dry Ice fees will be extra-charged
Uniprot: P43246
Gene Name: MSH2
Expression System: Escherichia coli
Molecular Weight: 21 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 94%
Start Site: Thr441
End Site: His610
Coverage: 0.18
Isoelectric Point: 5
Core Sequence: TDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDPNLSELREIMNDLEKKMQSTLISAARDLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNSKLTSLNEEYTKNKTEYEEAQDAIVKEIVNISSGYVEPMQTLNDVLAQLDAVVSFAH
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 94%, Pig - 98%, Cynomolgus monkey - 99%
Alternative gene names: /
Alternative protein names: DNA mismatch repair protein Msh2; hMSH2; MutS protein homolog 2
Protein name: mutS homolog 2
Full length: 934 amino acids
Entry name: MSH2_HUMAN
Product panel: IHC Pathology,DNA binding & Chromatin
English
Deutsch
