Recombinant Human MSH2 Protein

Recombinant Human MSH2 Protein
SKU
ASBPP-293-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P43246

Gene Name: MSH2

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Thr441

End Site: His610

Coverage: 0.18

Isoelectric Point: 5

Core Sequence: TDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDPNLSELREIMNDLEKKMQSTLISAARDLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNSKLTSLNEEYTKNKTEYEEAQDAIVKEIVNISSGYVEPMQTLNDVLAQLDAVVSFAH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 94%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: DNA mismatch repair protein Msh2; hMSH2; MutS protein homolog 2

Protein name: mutS homolog 2

Full length: 934 amino acids

Entry name: MSH2_HUMAN

Product panel: IHC Pathology,DNA binding & Chromatin
More Information
SKU ASBPP-293-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-293-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 4436
Product information (PDF)
×
MSDS (PDF)
×