Recombinant Human NAP1L2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9ULW6

Gene Name: NAP1L2

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Glu221

End Site: Ser310

Coverage: 0.20

Isoelectric Point: 4.5

Core Sequence: EDDIEATGEENKEEEDPKGIPDFWLTVLKNVDTLTPLIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNELLTKTYVLKS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Rat - 65%, Pig - 94%, Cynomolgus monkey - 98%

Alternative gene names: BPX

Alternative protein names: Nucleosome assembly protein 1-like 2; Brain-specific protein; X-linked

Protein name: nucleosome assembly protein 1 like 2

Full length: 460 amino acids

Entry name: NP1L2_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2931-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2931-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 4674