Recombinant Human NOL12 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UGY1

Gene Name: NOL12

Expression System: Escherichia coli

Molecular Weight: 22 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Ser21

End Site: Pro190

Coverage: 0.85

Isoelectric Point: 10.5

Core Sequence: SFDEEKRREYLTGFHKRKVERKKAAIEEIKQRLKEEQRKLREERHQEYLKMLAEREEALEEADELDRLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLTPPEGGAGDRSEEEASSTEKPTKALPRKSRDPLLSQRISSLTASLHAHSRKKVKRKHPRRAQDSKKP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 88%, Pig - 92%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Nucleolar protein 12

Protein name: nucleolar protein 12

Full length: 213 amino acids

Entry name: NOL12_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2891-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2891-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 79159