Recombinant Human NYNRIN Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9P2P1

Gene Name: NYNRIN

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 82%

Start Site: Arg881

End Site: Gln1000

Coverage: 0.06

Isoelectric Point: 5

Core Sequence: RFMVKLAEETDGIIVTNEQIHILMNSSKKLMVKDRLLPFTFAGNLFMVPDDPLGRDGPTLDEFLKKPNRLDTDIGNFLKVWKTLPPSSASVTELSDDADSGPLESLPNMEEVREEKEERQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Rat - 48%, Pig - 90%, Cynomolgus monkey - 98%

Alternative gene names: CGIN1; KIAA1305

Alternative protein names: Protein NYNRIN; NYN domain and retroviral integrase catalytic domain-containing protein; Protein cousin of GIN1

Protein name: NYN domain and retroviral integrase containing

Full length: 1898 amino acids

Entry name: NYNRI_HUMAN

• SKU: ASBPP-2875-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2875-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 57523