Recombinant Human OBP2A Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NY56

Gene Name: OBP2A

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 39%

Start Site: Pro41

End Site: Lys150

Coverage: 0.79

Isoelectric Point: 10

Core Sequence: PEDRRPRKVSPVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYMGKLVGRNPNTNLEALEEFKKLVQHK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 39%, Rat - 38%, Pig - 57%, Cynomolgus monkey - 45%

Alternative gene names: /

Alternative protein names: Odorant-binding protein 2a; Odorant-binding protein IIa; OBPIIa

Protein name: odorant binding protein 2A

Full length: 170 amino acids

Entry name: OBP2A_HUMAN

• SKU: ASBPP-2849-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2849-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 29991