Recombinant Human PCDHA4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UN74

Gene Name: PCDHA4

Expression System: Escherichia coli

Molecular Weight: 20 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Asp781

End Site: Ser940

Coverage: 0.18

Isoelectric Point: 9

Core Sequence: DREDQLQTTEESFAKPRQPNPDWRYSASLRAGMHSSVHLEEAGILRAGPGGPDQQWPTVSSATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQSGPGELPDKFIIPGSPAIISIRQEPTNSQIDKSDFITFGKKEETKKKKKKKKGNKTQEKKEKGNS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 95%, Pig - 99%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Protocadherin alpha-4; PCDH-alpha-4

Protein name: protocadherin alpha 4

Full length: 947 amino acids

Entry name: PCDA4_HUMAN

• SKU: ASBPP-2936-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2936-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 56144