Recombinant Human PDS5B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NTI5

Gene Name: PDS5B

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Lys1171

End Site: Asp1260

Coverage: 0.06

Isoelectric Point: 6.5

Core Sequence: KGRLDSSEMDHSENEDYTMSSPLPGKKSDKRDDSDLVRSELEKPRGRKKTPVTEQEEKLGMDDLTKLVQEQKPKGSQRSRKRGHTASESD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Rat - 89%, Pig - 94%, Cynomolgus monkey - 99%

Alternative gene names: APRIN; AS3; KIAA0979

Alternative protein names: Sister chromatid cohesion protein PDS5 homolog B; Androgen-induced proliferation inhibitor; Androgen-induced prostate proliferative shutoff-associated protein AS3

Protein name: PDS5 cohesin associated factor B

Full length: 1447 amino acids

Entry name: PDS5B_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2825-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2825-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 23047