Recombinant Human PKD2L2 Protein

Recombinant Human PKD2L2 Protein
SKU
ASBPP-2862-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NZM6

Gene Name: PKD2L2

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 80%

Start Site: Tyr501

End Site: Ala600

Coverage: 0.18

Isoelectric Point: 6.5

Core Sequence: YSIGRRLDFELGKMIKQSYKNVLEKFRLKKAQKDEDKKTKGSGDLAEQARREGFDENEIQNAEQMKKWKERLEKKYYSMEIQDDYQPVTQEEFRELFLYA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 80%, Pig - 85%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Polycystin-2-like protein 2; Polycystin-2L2; Polycystic kidney disease 2-like 2 protein; Polycystin-L2

Protein name: polycystin 2 like 2, transient receptor potential cation channel

Full length: 624 amino acids

Entry name: PK2L2_HUMAN
More Information
SKU ASBPP-2862-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2862-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 27039
Product information (PDF)
×
MSDS (PDF)
×