Recombinant Human PMEL Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P40967

Gene Name: PMEL

Expression System: Escherichia coli

Molecular Weight: 9.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Ser371

End Site: Asp440

Coverage: 0.12

Isoelectric Point: 4

Core Sequence: STGMTPEKVPVSEVMGTTLAEMSTPEATGMTPAEVSIVVLSGTTAAQVTTTEWVETTARELPIPEPEGPD

Homologies: Highest protein sequence identity to the following orthologs: Pig - 58%, Cynomolgus monkey - 93%

Alternative gene names: D12S53E; PMEL17; SILV

Alternative protein names: Melanocyte protein PMEL; ME20-M; ME20M; Melanocyte protein Pmel 17; Melanocytes lineage-specific antigen GP100; Melanoma-associated ME20 antigen; P1; P100; Premelanosome protein; Silver locus protein homolog) [Cleaved into: M-alpha; 95 kDa melanocyte-specific secreted glycoprotein; P26; Secreted melanoma-associated ME20 antigen; ME20-S; ME20S; M-beta]

Protein name: premelanosome protein

Full length: 661 amino acids

Entry name: PMEL_HUMAN

• SKU: ASBPP-286-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-286-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 6490