Recombinant Human POGK Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9P215

Gene Name: POGK

Expression System: Escherichia coli

Molecular Weight: 28.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 86%

Start Site: Ser11

End Site: Asn230

Coverage: 0.38

Isoelectric Point: 4

Core Sequence: SLKEEEEEEEIQSRELEDGPADMQKVRICSEGGWVPALFDEVAIYFSDEEWEVLTEQQKALYREVMRMNYETVLSLEFPFPKPDMITRLEGEEESQNSDEWQLQGGTSAENEESDVKPPDWPNPMNATSQFPQPQHFDSFGLRLPRDITELPEWSEGYPFYMAMGFPGYDLSADDIAGKFQFSRGMRRSYDAGFKLMVVEYAESTNNCQAAKQFGVLEKN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 86%, Rat - 38%, Pig - 93%, Cynomolgus monkey - 98%

Alternative gene names: KIAA1513

Alternative protein names: Pogo transposable element with KRAB domain

Protein name: pogo transposable element derived with KRAB domain

Full length: 609 amino acids

Entry name: POGK_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2869-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2869-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 57645