Recombinant Human POLK Protein

Recombinant Human POLK Protein
SKU
ASBPP-2881-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UBT6

Gene Name: POLK

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 53%

Start Site: Glu611

End Site: Ser750

Coverage: 0.16

Isoelectric Point: 5

Core Sequence: EISENSDDCQILTCPVCFRAQGCISLEALNKHVDECLDGPSISENFKMFSCSHVSATKVNKKENVPASSLCEKQDYEAHPKIKEISSVDCIALVDTIDNSSKAESIDALSNKHSKEECSSLPSKSFNIEHCHQNSSSTVS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 53%, Pig - 64%, Cynomolgus monkey - 90%

Alternative gene names: DINB1

Alternative protein names: DNA polymerase kappa; DINB protein; DINP

Protein name: DNA polymerase kappa

Full length: 870 amino acids

Entry name: POLK_HUMAN

Product panel: DNA binding & Chromatin,Enzyme
More Information
SKU ASBPP-2881-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2881-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 51426
Product information (PDF)
×
MSDS (PDF)
×