Recombinant Human RMI1 Protein

Recombinant Human RMI1 Protein
SKU
ASBPP-2779-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9H9A7

Gene Name: RMI1

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 54%

Start Site: Ile291

End Site: Tyr450

Coverage: 0.27

Isoelectric Point: 6

Core Sequence: ISPRPKEEPSNLSIHVMDGELDDFSLEEALLLEETVQKEQMETKELQPLTFNRNADRSIERFSHNPNTTNNFSLTCKNGNNNWSEKNVSEQMTNEDKSFGCPSVRDQNRSIFSVHCNVPLAHDFTNKEKNLETDNKIKQTSSSDSHSLNNKILNREVVNY

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 54%, Pig - 71%, Cynomolgus monkey - 92%

Alternative gene names: C9orf76

Alternative protein names: RecQ-mediated genome instability protein 1; BLM-associated protein of 75 kDa; BLAP75; FAAP75

Protein name: RecQ mediated genome instability 1

Full length: 625 amino acids

Entry name: RMI1_HUMAN
More Information
SKU ASBPP-2779-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2779-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 80010
Product information (PDF)
×
MSDS (PDF)
×