Note: Dry Ice fees will be extra-charged
Uniprot: Q9NV58
Gene Name: RNF19A
Expression System: Escherichia coli
Molecular Weight: 16.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 81%
Start Site: Glu691
End Site: Leu810
Coverage: 0.16
Isoelectric Point: 4.5
Core Sequence: EDMDAQLLEQQSTNSSEFEAPSLSDSMPSVADSHSSHFSEFSCSDLESMKTSCSHGSSDYHTRFATVNILPEVENDRLENSPHQCSISVVTQTASCSEVSQLNHIAEEHGNNGIKPNVDL
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 81%, Pig - 93%, Cynomolgus monkey - 96%
Alternative gene names: RNF19
Alternative protein names: E3 ubiquitin-protein ligase RNF19A; Double ring-finger protein; Dorfin; RING finger protein 19A; p38
Protein name: ring finger protein 19A, RBR E3 ubiquitin protein ligase
Full length: 838 amino acids
Entry name: RN19A_HUMAN
Product panel: E3 Ligase,Enzyme
English
Deutsch
