Recombinant Human RPRD1B Protein

Recombinant Human RPRD1B Protein
SKU
ASBPP-2812-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NQG5

Gene Name: RPRD1B

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Glu141

End Site: Thr310

Coverage: 0.53

Isoelectric Point: 5

Core Sequence: EEKKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAASGDATVRQKIASLPQEVQDVSLLEKITDKEAAERLSKTVDEACLLLAEYNGRLAAELEDRRQLARMLVEYTQNQKDVLSEKEKKLEEYKQKLARVTQVRKELKSHIQSLPDLSLLPNVT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: C20orf77; CREPT

Alternative protein names: Regulation of nuclear pre-mRNA domain-containing protein 1B; Cell cycle-related and expression-elevated protein in tumor

Protein name: regulation of nuclear pre-mRNA domain containing 1B

Full length: 326 amino acids

Entry name: RPR1B_HUMAN
More Information
SKU ASBPP-2812-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2812-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 58490
Product information (PDF)
×
MSDS (PDF)
×