Recombinant Human RTN4 Protein

Recombinant Human RTN4 Protein
SKU
ASBPP-2811-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NQC3

Gene Name: RTN4

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 61%

Start Site: Tyr251

End Site: Lys400

Coverage: 0.13

Isoelectric Point: 4.5

Core Sequence: YLGNLSTVLPTEGTLQENVSEASKEVSEKAKTLLIDRDLTEFSELEYSEMGSSFSVSPKAESAVIVANPREEIIVKNKDEEEKLVSNNILHNQQELPTALTKLVKEDEVVSSEKAKDSFNEKRVAVEAPMREEYADFKPFERVWEVKDSK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 61%, Rat - 60%, Pig - 73%, Cynomolgus monkey - 91%

Alternative gene names: KIAA0886; NOGO

Alternative protein names: Reticulon-4; Foocen; Neurite outgrowth inhibitor; Nogo protein; Neuroendocrine-specific protein; NSP; Neuroendocrine-specific protein C homolog; RTN-x; Reticulon-5

Protein name: reticulon 4

Full length: 1192 amino acids

Entry name: RTN4_HUMAN
More Information
SKU ASBPP-2811-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2811-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 57142
Product information (PDF)
×
MSDS (PDF)
×