Recombinant Human SALL1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NSC2

Gene Name: SALL1

Expression System: Escherichia coli

Molecular Weight: 17 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: His11

End Site: Ser150

Coverage: 0.10

Isoelectric Point: 5.5

Core Sequence: HFQSDPEVASLPRRDGDTEKGQPSRPTKSKDAHVCGRCCAEFFELSDLLLHKKNCTKNQLVLIVNENPASPPETFSPSPPPDNPDEQMNDTVNKTDQVDCSDLSEHNGLDREESMEVEAPVANKSGSGTSSGSHSSTAPS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Pig - 89%, Cynomolgus monkey - 99%

Alternative gene names: SAL1; ZNF794

Alternative protein names: Sal-like protein 1; Spalt-like transcription factor 1; Zinc finger protein 794; Zinc finger protein SALL1; Zinc finger protein Spalt-1; HSal1; Sal-1

Protein name: spalt like transcription factor 1

Full length: 1324 amino acids

Entry name: SALL1_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2822-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2822-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 6299