Recombinant Human SEPSECS Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HD40

Gene Name: SEPSECS

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Thr181

End Site: Asn360

Coverage: 0.36

Isoelectric Point: 6.5

Core Sequence: TAGFEPVVIENVLEGDELRTDLKAVEAKVQELGPDCILCIHSTTSCFAPRVPDRLEELAVICANYDIPHIVNNAYGVQSSKCMHLIQQGARVGRIDAFVQSLDKNFMVPVGGAIIAGFNDSFIQEISKMYPGRASASPSLDVLITLLSLGSNGYKKLLKERKEMFSYLSNQIKKLSEAYN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%

Alternative gene names: TRNP48

Alternative protein names: O-phosphoseryl-tRNA(Sec) selenium transferase; Liver-pancreas antigen; LP; SLA-p35; SLA/LP autoantigen; Selenocysteine synthase; Sec synthase; Selenocysteinyl-tRNA(Sec) synthase; Sep-tRNA:Sec-tRNA synthase; SepSecS; Soluble liver antigen; SLA; UGA suppressor tRNA-associated protein; tRNA(Ser/Sec)-associated antigenic protein

Protein name: Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase

Full length: 501 amino acids

Entry name: SPCS_HUMAN

Product panel: Autoimmune Disease,Enzyme

• SKU: ASBPP-10755-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10755-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 51091