Recombinant Human SNRK Protein

Recombinant Human SNRK Protein
SKU
ASBPP-10345-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NRH2

Gene Name: SNRK

Expression System: Escherichia coli

Molecular Weight: 18.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Pro391

End Site: Lys530

Coverage: 0.20

Isoelectric Point: 8

Core Sequence: PARAADSVLNGHRSKGLCDSAKKDDLPELAGPALSTVPPASLKPTASGRKCLFRVEEDEEEDEEDKKPMSLSTQVVLRRKPSVTNRLTSRKSAPVLNQIFEEGESDDEFDMDENLPPKLSRLKMNIASPGTVHKRYHRRK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 97%, Pig - 97%, Cynomolgus monkey - 99%

Alternative gene names: KIAA0096; SNFRK

Alternative protein names: SNF-related serine/threonine-protein kinase; SNF1-related kinase

Protein name: SNF related kinase

Full length: 765 amino acids

Entry name: SNRK_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-10345-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10345-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 54861
Product information (PDF)
×
MSDS (PDF)
×