Recombinant Human TBC1D22B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NU19

Gene Name: TBC1D22B

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 44%

Start Site: Lys11

End Site: His150

Coverage: 0.30

Isoelectric Point: 10

Core Sequence: KRSAKLPGSIQPVYGAQHPPLDPRLTKNFIKERSKVNTVPLKNKKASSFHEFARNTSDAWDIGDDEEEDFSSPSFQTLNSKVALATAAQVLENHSKLRVKPERSQSTTSDVPANYKVIKSSSDAQLSRNSSDTCLRNPLH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 44%, Pig - 97%, Cynomolgus monkey - 99%

Alternative gene names: C6orf197

Alternative protein names: TBC1 domain family member 22B

Protein name: TBC1 domain family member 22B

Full length: 505 amino acids

Entry name: TB22B_HUMAN

• SKU: ASBPP-2827-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2827-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 55633