Recombinant Human TCF7L2 Protein

Recombinant Human TCF7L2 Protein
SKU
ASBPP-2810-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NQB0

Gene Name: TCF7L2

Expression System: Escherichia coli

Molecular Weight: 30 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Ser291

End Site: Pro540

Coverage: 0.41

Isoelectric Point: 10

Core Sequence: SRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 79%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: TCF4

Alternative protein names: Transcription factor 7-like 2; HMG box transcription factor 4; T-cell-specific transcription factor 4; T-cell factor 4; TCF-4; hTCF-4

Protein name: transcription factor 7 like 2

Full length: 619 amino acids

Entry name: TF7L2_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2810-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2810-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 6934
Product information (PDF)
×
MSDS (PDF)
×