Recombinant Human TES Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UGI8

Gene Name: TES

Expression System: Escherichia coli

Molecular Weight: 26.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 88%

Start Site: Gly11

End Site: Gly220

Coverage: 0.53

Isoelectric Point: 8.5

Core Sequence: GLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEEDRKVGKLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 88%, Rat - 93%, Pig - 96%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Testin; TESS

Protein name: testin LIM domain protein

Full length: 421 amino acids

Entry name: TES_HUMAN

• SKU: ASBPP-8386-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-8386-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 26136