Recombinant Human THPO Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P40225

Gene Name: THPO

Expression System: Escherichia coli

Molecular Weight: 48 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 71%

Start Site: Ser22

End Site: Gly353

Coverage: 1.00

Isoelectric Point: 8.5

Core Sequence: SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 71%, Rat - 76%, Pig - 74%, Cynomolgus monkey - 96%

Alternative gene names: MGDF

Alternative protein names: Thrombopoietin; C-mpl ligand; ML; Megakaryocyte colony-stimulating factor; Megakaryocyte growth and development factor; MGDF; Myeloproliferative leukemia virus oncogene ligand

Protein name: thrombopoietin

Full length: 353 amino acids

Entry name: TPO_HUMAN

Product panel: IHC Pathology,Cytokines

• SKU: ASBPP-284-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-284-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 7066