Recombinant Human TMCC3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9ULS5

Gene Name: TMCC3

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Tyr251

End Site: Leu390

Coverage: 0.31

Isoelectric Point: 4.5

Core Sequence: YGSDDECSSGTSGSADSNGNQSFGAGGASTLDSQGKLAVILEELREIKDTQAQLAEDIEALKVQFKREYGFISQTLQEERYRYERLEDQLHDLTDLHQHETANLKQELASIEEKVAYQAYERSRDIQEALESCQTRISKL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Pig - 92%, Cynomolgus monkey - 100%

Alternative gene names: KIAA1145

Alternative protein names: Transmembrane and coiled-coil domain protein 3

Protein name: transmembrane and coiled-coil domain family 3

Full length: 477 amino acids

Entry name: TMCC3_HUMAN

• SKU: ASBPP-2930-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2930-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 57458