Recombinant Human TRMT6 Protein

Recombinant Human TRMT6 Protein
SKU
ASBPP-2901-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UJA5

Gene Name: TRMT6

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 82%

Start Site: Lys261

End Site: Leu430

Coverage: 0.35

Isoelectric Point: 5.5

Core Sequence: KVDSLLHGTFSAKMLSSEPKDSALVEESNGTLEEKQASEQENEDSMAEAPESNHPEDQETMETISQDPEHKGPKERGSKKDYIQEKQRRQEEQRKRHLEAAALLSERNADGLIVASRFHPTPLLLSLLDFVAPSRPFVVYCQYKEPLLECYTKLRERGGVINLRLSETWL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Pig - 91%, Cynomolgus monkey - 99%

Alternative gene names: KIAA1153; TRM6

Alternative protein names: tRNA; adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6; mRNA methyladenosine-N(1)-methyltransferase non-catalytic subunit TRM6; tRNA(m1A58)-methyltransferase subunit TRM6; tRNA(m1A58)MTase subunit TRM6

Protein name: tRNA methyltransferase 6 non-catalytic subunit

Full length: 497 amino acids

Entry name: TRM6_HUMAN
More Information
SKU ASBPP-2901-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2901-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 51605
Product information (PDF)
×
MSDS (PDF)
×