Recombinant Human USE1 Protein

Recombinant Human USE1 Protein
SKU
ASBPP-2856-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NZ43

Gene Name: USE1

Expression System: Escherichia coli

Molecular Weight: 18.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 87%

Start Site: Ser81

End Site: Glu220

Coverage: 0.61

Isoelectric Point: 9.5

Core Sequence: SEKALANQFLAPGRVPTTARERVPATKTVHLQSRARYTSEMRSELLGTDSAEPEMDVRKRTGVAGSQPVSEKQLAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Pig - 93%, Cynomolgus monkey - 99%

Alternative gene names: USE1L

Alternative protein names: Vesicle transport protein USE1; Putative MAPK-activating protein PM26; USE1-like protein; p31

Protein name: unconventional SNARE in the ER 1

Full length: 259 amino acids

Entry name: USE1_HUMAN
More Information
SKU ASBPP-2856-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2856-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 55850
Product information (PDF)
×
MSDS (PDF)
×