Recombinant Human YEATS2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9ULM3

Gene Name: YEATS2

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Pro1261

End Site: Lys1390

Coverage: 0.10

Isoelectric Point: 4.5

Core Sequence: PECPSSFSSADNLCRKLEDLQQFQKREPENEEEVDILSLSEPVKINIKKEQEEKQEEVKFYLPPTPGSEFIGDVTQKIGITLQPVALHRNVYASVVEDMILKATEQLVNDILRQALAVGYQTASHNRIPK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Pig - 96%, Cynomolgus monkey - 100%

Alternative gene names: KIAA1197

Alternative protein names: YEATS domain-containing protein 2

Protein name: YEATS domain containing 2

Full length: 1422 amino acids

Entry name: YETS2_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2928-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2928-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 55689