Recombinant Human ZBTB21 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9ULJ3

Gene Name: ZBTB21

Expression System: Escherichia coli

Molecular Weight: 22 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Val721

End Site: Ala890

Coverage: 0.16

Isoelectric Point: 5.5

Core Sequence: VYQCRLCNAKLSSLLEQGSHERLCRNAAVCPYCSLRFFSPELKQEHESKCEYKKLTCLECMRTFKSSFSIWRHQVEVHNQNNMAPTENFSLPVLDHNGDVTGSSRPQSQPEPNKVNHIVTTKDDNVFSDSSEQVNFDSEDSSCLPEDLSLSKQLKIQVKEEPVEEAEEEA

Homologies: Highest protein sequence identity to the following orthologs: Pig - 64%, Cynomolgus monkey - 99%

Alternative gene names: KIAA1227; ZNF295

Alternative protein names: Zinc finger and BTB domain-containing protein 21; Zinc finger protein 295

Protein name: zinc finger and BTB domain containing 21

Full length: 1066 amino acids

Entry name: ZBT21_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2923-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2923-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 49854