Recombinant Human ZNF214 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UL59

Gene Name: ZNF214

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 74%

Start Site: Cys391

End Site: Cys500

Coverage: 0.20

Isoelectric Point: 8.5

Core Sequence: CGKGFSQSSNLRIHQLVHTGEKSYKCEDCGKGFTQRSNLQIHQRVHTGEKPYKCDDCGKDFSHSSDLRIHQRVHTGEKPYTCPECGKGFSKSSKLHTHQRVHTGEKPYKC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 74%, Rat - 64%, Pig - 77%, Cynomolgus monkey - 98%

Alternative gene names: BAZ1

Alternative protein names: Zinc finger protein 214; BWSCR2-associated zinc finger protein 1; BAZ-1

Protein name: zinc finger protein 214

Full length: 606 amino acids

Entry name: ZN214_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2911-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2911-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 7761