Recombinant Human ZNF226 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NYT6

Gene Name: ZNF226

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Lys81

End Site: Lys200

Coverage: 0.15

Isoelectric Point: 6

Core Sequence: KNQSKLITVQDRESEEELSCWQIWQQIANDLTRCQDSMINNSQCHKQGDFPYQVGTELSIQISEDENYIVNKADGPNNTGNPEFPILRTQDSWRKTFLTESQRLNRDQQISIKNKLCQCK

Homologies: Highest protein sequence identity to the following orthologs: Pig - 65%, Cynomolgus monkey - 93%

Alternative gene names: /

Alternative protein names: Zinc finger protein 226

Protein name: zinc finger protein 226

Full length: 803 amino acids

Entry name: ZN226_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2853-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2853-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 7769