Recombinant Human ZNF236 Protein

Recombinant Human ZNF236 Protein
SKU
ASBPP-2910-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UL36

Gene Name: ZNF236

Expression System: Escherichia coli

Molecular Weight: 23 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 57%

Start Site: Glu831

End Site: Leu1010

Coverage: 0.10

Isoelectric Point: 6

Core Sequence: EEAGLGQQLADQPLEADEDGFVAPQDPLRGHVDQFEEQSPAQQSFEPAGLPQGFTVTDTYHQQPQFPPVQQLQDSSTLESQALSTSFHQQSLLQAPSSDGMNVTTRLIQESSQEELDLQAQGSQFLEDNEDQSRRSYRCDYCNKGFKKSSHLKQHVRSHTGEKPYKCKLCGRGFVSSGVL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 57%, Rat - 56%, Pig - 81%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Zinc finger protein 236

Protein name: zinc finger protein 236

Full length: 1845 amino acids

Entry name: ZN236_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2910-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2910-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 7776
Product information (PDF)
×
MSDS (PDF)
×