Recombinant Human ZNF391 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UJN7

Gene Name: ZNF391

Expression System: Escherichia coli

Molecular Weight: 18.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 64%

Start Site: Pro31

End Site: Leu180

Coverage: 0.43

Isoelectric Point: 9

Core Sequence: PAQKKSSFENTVVRKVSVTLKEIFTGEEGPESSEFSLSPNLDAQQKIPKGHGSPISRKNSKDNSDLIKHQRLFSQRKPCKCNECEKAFSYQSDLLVHSRIHGGEKPFECNKCGKSFSRSTHLIEHQRTHTGEKPYECNECGKAFSRSTHL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 64%, Rat - 64%, Pig - 79%, Cynomolgus monkey - 95%

Alternative gene names: /

Alternative protein names: Zinc finger protein 391

Protein name: zinc finger protein 391

Full length: 358 amino acids

Entry name: ZN391_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2902-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2902-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 346157