Recombinant Human ZNF446 Protein

Recombinant Human ZNF446 Protein
SKU
ASBPP-2841-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NWS9

Gene Name: ZNF446

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 33%

Start Site: Thr131

End Site: Pro310

Coverage: 0.40

Isoelectric Point: 5

Core Sequence: TEEPLGSPHPSGTVESPGEGPQDTRIEGSVQLSCSVKEEPNVDGQEVAPSSPPLAAQSPEGNHGHQEPASTSFHPPRIQEEWGLLDRSQKELYWDAMLEKYGTVVSLGLPPHQPEAQAQSELGMLLTGTGVCRSLRSGNESEGPPGCPEAQPPQGPGPAAWEGLSGAATPAPTVRPGTPP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 33%, Rat - 32%, Pig - 59%, Cynomolgus monkey - 94%

Alternative gene names: ZKSCAN20

Alternative protein names: Zinc finger protein 446; Zinc finger protein with KRAB and SCAN domains 20

Protein name: zinc finger protein 446

Full length: 450 amino acids

Entry name: ZN446_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2841-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2841-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 55663
Product information (PDF)
×
MSDS (PDF)
×