Recombinant Human ZNF490 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9ULM2

Gene Name: ZNF490

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 46%

Start Site: Gly31

End Site: Pro150

Coverage: 0.24

Isoelectric Point: 5.5

Core Sequence: GTGGSDVLQMQNSEHHGQSIKTQTDSISLEDVAVNFTLEEWALLDPGQRNIYRDVMRATFKNLACIGEKWKDQDIEDEHKNQGRNLRSPMVEALCENKEDCPCGKSTSQIPDLNTNLETP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 46%, Rat - 48%, Pig - 64%, Cynomolgus monkey - 91%

Alternative gene names: KIAA1198

Alternative protein names: Zinc finger protein 490

Protein name: zinc finger protein 490

Full length: 529 amino acids

Entry name: ZN490_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2926-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2926-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 57474